PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA026532-PA
Common NameOsI_30146
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family SRS
Protein Properties Length: 302aa    MW: 30663.8 Da    PI: 8.4242
Description SRS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA026532-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF702220.14.8e-68892293154
            DUF702   3 sgtasCqdCGnqakkdCaheRCRtCCksrgfdCathvkstWvpaakrrerqqqlaaasskaaasaaeaaskrkrelkskkqsalsstklssae 95 
                        gt+sCqdCGnqakkdC+h RCRtCCksrgfdCathvkstWvpaakrrerq+ la+a         +++skr+r++  ++++++++ ++ss+e
  BGIOSGA026532-PA  89 GGTISCQDCGNQAKKDCTHLRCRTCCKSRGFDCATHVKSTWVPAAKRRERQNLLASA---------AESSKRPRDS--AAAATSTTPTTSSGE 170
                       5899***********************************************999986.........6778999997..6666777788899** PP

            DUF702  96 skkeletsslPeevsseavfrcvrvssvddgeeelaYqtavsigGhvfkGiLydqGlee 154
                       +++++  +++P+evsseavfrcvr++ v+++++e+aYqt+vsigGhvfkGiL+d G+e+
  BGIOSGA026532-PA 171 QQQMMVGERFPREVSSEAVFRCVRLGPVEEADAEVAYQTTVSIGGHVFKGILHDVGPEH 229
                       *********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF051423.6E-5991228IPR007818Protein of unknown function DUF702
TIGRFAMsTIGR016234.0E-2793135IPR006510Zinc finger, lateral root primordium type 1
TIGRFAMsTIGR016244.2E-23179227IPR006511Lateral Root Primordium type 1, C-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 302 aa     Download sequence    Send to blast
MAGFPLGGGG GRHGRDDHHR PPVNPTDSAA AFLYASTASR GGFQLWQQQP PPAAHPFYAQ  60
NIIRFADDPA APPSSRGGRG GGPGGSGGGG TISCQDCGNQ AKKDCTHLRC RTCCKSRGFD  120
CATHVKSTWV PAAKRRERQN LLASAAESSK RPRDSAAAAT STTPTTSSGE QQQMMVGERF  180
PREVSSEAVF RCVRLGPVEE ADAEVAYQTT VSIGGHVFKG ILHDVGPEHS SGGGGGMGGR  240
HAAAGEAGSS PSTAAAPHGG GEGGSSGVAA AAAAVSSSAV VMDPYPTPGP FGGAHFFHGH  300
PR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.1011950.0panicle
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0047040.0AP004704.3 Oryza sativa Japonica Group genomic DNA, chromosome 8, PAC clone:P0544G09.
GenBankAP0062650.0AP006265.2 Oryza sativa Japonica Group genomic DNA, chromosome 8, BAC clone:OJ1112_E06.
GenBankAP0149640.0AP014964.1 Oryza sativa Japonica Group DNA, chromosome 8, cultivar: Nipponbare, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015648772.10.0PREDICTED: protein SHI RELATED SEQUENCE 1
TrEMBLA2YXT00.0A2YXT0_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA026532-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP135435124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G51060.12e-49Lateral root primordium (LRP) protein-related